SCOPe 2.08: Domain d1orda2: 1ord A:108-569

Lineage for d1orda2 (1ord A:108-569)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.5: Ornithine decarboxylase major domain [53444] (1 protein)
   automatically mapped to Pfam PF01276

6. Protein Ornithine decarboxylase major domain [53445] (1 species)

7. Species Lactobacillus sp., strain 30a [TaxId:1591] [53446] (2 PDB entries)

8. Domain d1orda2: 1ord A:108-569 [34503]
   Other proteins in same PDB: d1orda1, d1orda3, d1ordb1, d1ordb3
   complexed with plp

Details for d1orda2

PDB Entry: 1ord, 3 Å

PDB Description: crystallographic structure of a plp-dependent ornithine decarboxylase from lactobacillus 30a to 3.1 angstroms resolution

PDB Compounds: (A:) ornithine decarboxylase

SCOPe Domain Sequences for d1orda2:

Sequence; same for both SEQRES and ATOM records:

>d1orda2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]}
ppffkslkeyvsrgliqfdcpghqggqyyrkhpagrefydffgetvfradlcnadvalgd
llihegpavaaekhaarvynadktyfvlggssnanntvtsalvsngdlvlfdrnnhksvy
nsalamaggrpvylqtnrnpygfiggiydsdfdekkirelaakvdperakwkrpfrlavi
qlgtydgtiynahevvkrighlcdyiefdsawvgyeqfipmmrnssplliddlgpedpgi
ivvqsvhkqqagfsqtsqihkkdshikgqlrycdhkhfnnsfnlfmstspfypmyaaldv
naamqegeagrklwhdllittiearkklikagsmfrpfvppvvngkkwedgdtedmanni
dywrfekgakwhayegygdnqyyvdpnkfmlttpginpetgdyedfgvpativanylrdh
giipeksdlnsilflmtpaetpakmnnlitqllqlqrlieed

Timeline for d1orda2:

• d1orda2 first appeared (with stable ids) in SCOP 1.55
  
• d1orda2 appears in SCOPe 2.07