Lineage for d3u1ma1 (3u1m A:2-126)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2589401Fold g.66: CCCH zinc finger [90228] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2589402Superfamily g.66.1: CCCH zinc finger [90229] (2 families) (S)
  5. 2589418Family g.66.1.2: Pre-mRNA splicing factor Cwc2 / Cwf2 / Prp3, zinc finger domain [345986] (1 protein)
    Pfam PF16131; Zinc finger is surrounded by additional short helices and loops
  6. 2589419Protein Pre-mRNA splicing factor Cwc2 / Cwf2 / Prp3, zinc finger domain [346127] (2 species)
  7. 2589420Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346437] (3 PDB entries)
  8. 2589422Domain d3u1ma1: 3u1m A:2-126 [345017]
    Other proteins in same PDB: d3u1ma2
    protein/RNA complex; complexed with zn

Details for d3u1ma1

PDB Entry: 3u1m (more details), 1.95 Å

PDB Description: Structure of the mRNA splicing complex component Cwc2
PDB Compounds: (A:) Pre-mRNA-splicing factor CWC2

SCOPe Domain Sequences for d3u1ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u1ma1 g.66.1.2 (A:2-126) Pre-mRNA splicing factor Cwc2 / Cwf2 / Prp3, zinc finger domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tswrdksakvqvkeselpssipaqtgltfniwynkwsqgfagntrfvspfalqpqlhsgk
trgdndgqlffclffakgmcclgpkceylhhipdeedigklalrtevldcfgrekfadyr
edmgg

SCOPe Domain Coordinates for d3u1ma1:

Click to download the PDB-style file with coordinates for d3u1ma1.
(The format of our PDB-style files is described here.)

Timeline for d3u1ma1:

  • d3u1ma1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3u1ma2