Lineage for d3tp2b2 (3tp2 B:133-227)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518968Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2518969Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2519195Protein Pre-mRNA splicing factor Cwc2 / Cwf2 / Prp3, RRM domain [346093] (2 species)
  7. 2519196Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346356] (3 PDB entries)
  8. 2519200Domain d3tp2b2: 3tp2 B:133-227 [345008]
    Other proteins in same PDB: d3tp2a1, d3tp2b1
    automated match to d3u1ma2
    complexed with na, zn

Details for d3tp2b2

PDB Entry: 3tp2 (more details), 2.4 Å

PDB Description: Crystal Structure of the Splicing Factor Cwc2 from yeast
PDB Compounds: (B:) Pre-mRNA-splicing factor CWC2

SCOPe Domain Sequences for d3tp2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tp2b2 d.58.7.1 (B:133-227) Pre-mRNA splicing factor Cwc2 / Cwf2 / Prp3, RRM domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
knktlyvggidgalnskhlkpaqiesrirfvfsrlgdidriryveskncgfvkfkyqana
efakeamsnqtlllpsdkewddrregtgllvkwan

SCOPe Domain Coordinates for d3tp2b2:

Click to download the PDB-style file with coordinates for d3tp2b2.
(The format of our PDB-style files is described here.)

Timeline for d3tp2b2:

  • d3tp2b2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3tp2b1