Lineage for d3rosa_ (3ros A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481726Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2481727Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2482164Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2482165Protein automated matches [190683] (58 species)
    not a true protein
  7. 2482428Species Lactobacillus acidophilus [TaxId:1579] [346330] (1 PDB entry)
  8. 2482429Domain d3rosa_: 3ros A: [345000]
    automated match to d3efva_
    complexed with so4

Details for d3rosa_

PDB Entry: 3ros (more details), 1.88 Å

PDB Description: Crystal structure of NAD-dependent aldehyde dehydrogenase from Lactobacillus acidophilus
PDB Compounds: (A:) NAD-dependent aldehyde dehydrogenase

SCOPe Domain Sequences for d3rosa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rosa_ c.82.1.0 (A:) automated matches {Lactobacillus acidophilus [TaxId: 1579]}
mskyqsvnpytneafasydnptskqideainlahalykkwrheepasraeilhdianalk
ehedelakmmtlemgkllseskeevelcvsicnyyadhgpemlkptklnsdlgnayylkq
stgvimacepwnfplyqvirvfapnfivgnpillkhahnvpgsaaltakiikragapegs
linlypsydqladiiadpriqgvaltgserggsavaeaagknlkkstmelggndafivld
dadpqvlrnvlndartyndgqvctsskriiveksrydevlhelknvfsnlkagdpleadt
tlppmnsekakekleaqvkeaidagakvfyqypeidskgaffrptiltdiakdnpvfdke
vfgpiaevfvveddnaaiqlandssyglgssvigsdidrakkvsaqietgmtvingrwit
sgelpfggikksgygrelsglglmafvnehlvidvtknn

SCOPe Domain Coordinates for d3rosa_:

Click to download the PDB-style file with coordinates for d3rosa_.
(The format of our PDB-style files is described here.)

Timeline for d3rosa_:

  • d3rosa_ is new in SCOPe 2.07-stable