Lineage for d3qf4b2 (3qf4 B:340-597)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2873005Species Thermotoga maritima [TaxId:2336] [188476] (8 PDB entries)
  8. 2873014Domain d3qf4b2: 3qf4 B:340-597 [344992]
    Other proteins in same PDB: d3qf4b1
    automated match to d5mkka2
    complexed with anp, mg

Details for d3qf4b2

PDB Entry: 3qf4 (more details), 2.9 Å

PDB Description: crystal structure of a heterodimeric abc transporter in its inward- facing conformation
PDB Compounds: (B:) Uncharacterized ABC transporter ATP-binding protein TM_0288

SCOPe Domain Sequences for d3qf4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qf4b2 c.37.1.0 (B:340-597) automated matches {Thermotoga maritima [TaxId: 2336]}
kddpdavelrevrgeiefknvwfsydkkkpvlkditfhikpgqkvalvgptgsgkttivn
llmrfydvdrgqilvdgidirkikrsslrssigivlqdtilfsttvkenlkygnpgatde
eikeaaklthsdhfikhlpegyetvltdngedlsqgqrqllaitraflanpkilildeat
snvdtkteksiqaamwklmegktsiiiahrlntiknadliivlrdgeivemgkhdeliqk
rgfyyelftsqyglvvek

SCOPe Domain Coordinates for d3qf4b2:

Click to download the PDB-style file with coordinates for d3qf4b2.
(The format of our PDB-style files is described here.)

Timeline for d3qf4b2: