Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [188476] (8 PDB entries) |
Domain d3qf4b2: 3qf4 B:340-597 [344992] Other proteins in same PDB: d3qf4b1 automated match to d5mkka2 complexed with anp, mg |
PDB Entry: 3qf4 (more details), 2.9 Å
SCOPe Domain Sequences for d3qf4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qf4b2 c.37.1.0 (B:340-597) automated matches {Thermotoga maritima [TaxId: 2336]} kddpdavelrevrgeiefknvwfsydkkkpvlkditfhikpgqkvalvgptgsgkttivn llmrfydvdrgqilvdgidirkikrsslrssigivlqdtilfsttvkenlkygnpgatde eikeaaklthsdhfikhlpegyetvltdngedlsqgqrqllaitraflanpkilildeat snvdtkteksiqaamwklmegktsiiiahrlntiknadliivlrdgeivemgkhdeliqk rgfyyelftsqyglvvek
Timeline for d3qf4b2: