Lineage for d3qf4b1 (3qf4 B:10-339)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2580483Fold f.37: ABC transporter transmembrane region [90122] (1 superfamily)
    multihelical; complex architecture with several transmembrane helices
  4. 2580484Superfamily f.37.1: ABC transporter transmembrane region [90123] (2 families) (S)
    automatically mapped to Pfam PF00664
  5. 2580515Family f.37.1.0: automated matches [328653] (1 protein)
    not a true family
  6. 2580516Protein automated matches [328654] (3 species)
    not a true protein
  7. 2580517Species Thermotoga maritima [TaxId:2336] [346426] (1 PDB entry)
  8. 2580518Domain d3qf4b1: 3qf4 B:10-339 [344991]
    Other proteins in same PDB: d3qf4b2
    automated match to d5mkka1
    complexed with anp, mg

Details for d3qf4b1

PDB Entry: 3qf4 (more details), 2.9 Å

PDB Description: crystal structure of a heterodimeric abc transporter in its inward- facing conformation
PDB Compounds: (B:) Uncharacterized ABC transporter ATP-binding protein TM_0288

SCOPe Domain Sequences for d3qf4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qf4b1 f.37.1.0 (B:10-339) automated matches {Thermotoga maritima [TaxId: 2336]}
gpilekpalknptatlrrllgylrphtftlimvfvfvtvssilgvlspyligktidvvfv
prrfdllprymlilgtiyaltsllfwlqgkimltlsqdvvfrlrkelfeklqrvpvgffd
rtphgdiisrvindvdninnvlgnsiiqffsgivtlagavimmfrvnvilslvtlsivpl
tvlitqivssqtrkyfyenqrvlgqlngiieedisgltviklftreekemekfdrvnesl
rkvgtkaqifsgvlpplmnmvnnlgfalisgfggwlalkdiitvgtiatfigysrqftrp
lnelsnqfnmiqmalasaerifeildleee

SCOPe Domain Coordinates for d3qf4b1:

Click to download the PDB-style file with coordinates for d3qf4b1.
(The format of our PDB-style files is described here.)

Timeline for d3qf4b1:

  • d3qf4b1 is new in SCOPe 2.07-stable