Lineage for d3pfib2 (3pfi B:256-324)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (78 species)
    not a true protein
  7. 2307213Species Campylobacter jejuni [TaxId:192222] [346167] (1 PDB entry)
  8. 2307215Domain d3pfib2: 3pfi B:256-324 [344983]
    Other proteins in same PDB: d3pfia1, d3pfib1
    automated match to d6blba2
    protein/DNA complex; complexed with adp

Details for d3pfib2

PDB Entry: 3pfi (more details), 2.7 Å

PDB Description: 2.7 angstrom resolution crystal structure of a probable holliday junction dna helicase (ruvb) from campylobacter jejuni subsp. jejuni nctc 11168 in complex with adenosine-5'-diphosphate
PDB Compounds: (B:) Holliday junction ATP-dependent DNA helicase ruvB

SCOPe Domain Sequences for d3pfib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pfib2 a.4.5.0 (B:256-324) automated matches {Campylobacter jejuni [TaxId: 192222]}
lgfdamdlrylelltaakqkpiglasiaaalsedentiedviepyllangyiertakgri
asaksysal

SCOPe Domain Coordinates for d3pfib2:

Click to download the PDB-style file with coordinates for d3pfib2.
(The format of our PDB-style files is described here.)

Timeline for d3pfib2:

  • d3pfib2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3pfib1