Lineage for d3pfia1 (3pfi A:20-255)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (144 species)
    not a true protein
  7. 2452057Species Campylobacter jejuni [TaxId:192222] [189931] (3 PDB entries)
  8. 2452063Domain d3pfia1: 3pfi A:20-255 [344980]
    Other proteins in same PDB: d3pfia2, d3pfib2
    automated match to d6blba1
    protein/DNA complex; complexed with adp

Details for d3pfia1

PDB Entry: 3pfi (more details), 2.7 Å

PDB Description: 2.7 angstrom resolution crystal structure of a probable holliday junction dna helicase (ruvb) from campylobacter jejuni subsp. jejuni nctc 11168 in complex with adenosine-5'-diphosphate
PDB Compounds: (A:) Holliday junction ATP-dependent DNA helicase ruvB

SCOPe Domain Sequences for d3pfia1:

Sequence, based on SEQRES records: (download)

>d3pfia1 c.37.1.0 (A:20-255) automated matches {Campylobacter jejuni [TaxId: 192222]}
lrpsnfdgyigqesikknlnvfiaaakkrnecldhilfsgpaglgkttlaniisyemsan
ikttaapmieksgdlaailtnlsegdilfideihrlspaieevlypamedyrldiiigsg
paaqtikidlpkftligattragmlsnplrdrfgmqfrlefykdselalilqkaalklnk
tceekaaleiakrsrstprialrllkrvrdfadvndeeiitekranealnslgvne

Sequence, based on observed residues (ATOM records): (download)

>d3pfia1 c.37.1.0 (A:20-255) automated matches {Campylobacter jejuni [TaxId: 192222]}
lrpsnfdgyigqesikknlnvfiaaakkrnecldhilfsgpaglgkttlaniisyemsan
ikttaapmieksgdlaailtnlsegdilfideihrlspaieevlypamedyrlaqtikid
lpkftligattragmlsnplrdrfgmqfrlefykdselalilqkaalklnktceekaale
iakrsrstprialrllkrvrdfadvndeeiitekranealnslgvne

SCOPe Domain Coordinates for d3pfia1:

Click to download the PDB-style file with coordinates for d3pfia1.
(The format of our PDB-style files is described here.)

Timeline for d3pfia1:

  • d3pfia1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3pfia2