Lineage for d3m62b_ (3m62 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (26 species)
    not a true protein
  7. 2502615Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186998] (8 PDB entries)
  8. 2502624Domain d3m62b_: 3m62 B: [344920]
    automated match to d2nbua_
    protein/DNA complex; complexed with 1pe, k

Details for d3m62b_

PDB Entry: 3m62 (more details), 2.4 Å

PDB Description: Crystal structure of Ufd2 in complex with the ubiquitin-like (UBL) domain of Rad23
PDB Compounds: (B:) UV excision repair protein RAD23

SCOPe Domain Sequences for d3m62b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m62b_ d.15.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sltfknfkkekvpldlepsntiletktklaqsisceesqikliysgkvlqdsktvsecgl
kdgdqvvfmvsq

SCOPe Domain Coordinates for d3m62b_:

Click to download the PDB-style file with coordinates for d3m62b_.
(The format of our PDB-style files is described here.)

Timeline for d3m62b_:

  • d3m62b_ is new in SCOPe 2.07-stable