Lineage for d3libi_ (3lib I:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970927Superfamily d.110.6: Sensory domain-like [103190] (5 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 2970986Family d.110.6.4: Histidine kinase family 1 (HK1) sensor domains [345974] (6 proteins)
    Pfam PF02743, contains double domain arrangement like LuxQ
  6. 2971008Protein MM_2965 [346104] (1 species)
  7. 2971009Species Methanosarcina mazei [TaxId:2209] [346379] (1 PDB entry)
  8. 2971018Domain d3libi_: 3lib I: [344918]
    complexed with k

Details for d3libi_

PDB Entry: 3lib (more details), 2.99 Å

PDB Description: crystal structure of the extracellular domain of the putative histidine kinase mmhk1s-z3
PDB Compounds: (I:) Hypothetical sensory transduction histidine kinase

SCOPe Domain Sequences for d3libi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3libi_ d.110.6.4 (I:) MM_2965 {Methanosarcina mazei [TaxId: 2209]}
eklayqqsvemasnyanqfdadmkanlaiartisttmesyetadrdeallilenllrdnp
hllgtyvafepdafdgkdaeytnspahdgtgrfvpywnkmngtasvapllhydssdyyql
pkatekdvltepyfyegvfmvsyvspimkegefagiggvdvsleyvdevvskvrtfdtgy
afmvsnsgvilshpthkdwigkkdlydfggeelekasrdikngigghletadpttgktvi
lfyepvetgdfafvlvvpkeemlagvadlre

SCOPe Domain Coordinates for d3libi_:

Click to download the PDB-style file with coordinates for d3libi_.
(The format of our PDB-style files is described here.)

Timeline for d3libi_: