![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.6: Sensory domain-like [103190] (5 families) ![]() alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
![]() | Family d.110.6.4: Histidine kinase family 1 (HK1) sensor domains [345974] (6 proteins) Pfam PF02743, contains double domain arrangement like LuxQ |
![]() | Protein MM_2965 [346104] (1 species) |
![]() | Species Methanosarcina mazei [TaxId:2209] [346379] (1 PDB entry) |
![]() | Domain d3libb_: 3lib B: [344911] complexed with k |
PDB Entry: 3lib (more details), 2.99 Å
SCOPe Domain Sequences for d3libb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3libb_ d.110.6.4 (B:) MM_2965 {Methanosarcina mazei [TaxId: 2209]} eklayqqsvemasnyanqfdadmkanlaiartisttmesyetadrdeallilenllrdnp hllgtyvafepdafdgkdaeytnspahdgtgrfvpywnkmngtasvapllhydssdyyql pkatekdvltepyfyegvfmvsyvspimkegefagiggvdvsleyvdevvskvrtfdtgy afmvsnsgvilshpthkdwigkkdlydfggeelekasrdikngigghletadpttgktvi lfyepvetgdfafvlvvpkeemlagvadlre
Timeline for d3libb_: