Lineage for d3keqb1 (3keq B:6-81)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (78 species)
    not a true protein
  7. 2307606Species Streptococcus agalactiae [TaxId:216495] [346168] (2 PDB entries)
  8. 2307610Domain d3keqb1: 3keq B:6-81 [344861]
    Other proteins in same PDB: d3keqa2, d3keqb2
    automated match to d1r72f3
    protein/DNA complex; complexed with nad

Details for d3keqb1

PDB Entry: 3keq (more details), 2.4 Å

PDB Description: crystal structure of a rex-family transcriptional regulatory protein from streptococcus agalactiae complexed with nad+
PDB Compounds: (B:) Redox-sensing transcriptional repressor rex

SCOPe Domain Sequences for d3keqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3keqb1 a.4.5.0 (B:6-81) automated matches {Streptococcus agalactiae [TaxId: 216495]}
sipkatakrlslyyrifkrfntdgiekasskqiadalgidsatvrrdfsyfgelgrrgfg
ydvkklmnffaeilnd

SCOPe Domain Coordinates for d3keqb1:

Click to download the PDB-style file with coordinates for d3keqb1.
(The format of our PDB-style files is described here.)

Timeline for d3keqb1:

  • d3keqb1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3keqb2