Lineage for d3k6kc_ (3k6k C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2476490Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2476491Protein automated matches [190543] (108 species)
    not a true protein
  7. 2477367Species Uncultured bacterium [TaxId:77133] [196706] (27 PDB entries)
  8. 2477407Domain d3k6kc_: 3k6k C: [344853]
    automated match to d5gmra_
    complexed with bme, so4

Details for d3k6kc_

PDB Entry: 3k6k (more details), 2.2 Å

PDB Description: crystal structure at 2.2 angstrom of hsl-homolog este7 from a metagenome library
PDB Compounds: (C:) Esterase/lipase

SCOPe Domain Sequences for d3k6kc_:

Sequence, based on SEQRES records: (download)

>d3k6kc_ c.69.1.0 (C:) automated matches {Uncultured bacterium [TaxId: 77133]}
tkmdprdflqllkinaekaeknlpldqkragmealcerfpraegveltltdlggvpcirq
atdgagaahilyfhgggyisgspsthlvlttqlakqssatlwsldyrlapenpfpaavdd
cvaayrallktagsadriiiagdsaggglttasmlkakedglpmpaglvmlspfvdltls
rwsnsnladrdflaepdtlgemselyvggedrknplispvyadlsglpemlihvgseeal
lsdsttlaeragaagvsvelkiwpdmphvfqmygkfvnaadisikeichwisaris

Sequence, based on observed residues (ATOM records): (download)

>d3k6kc_ c.69.1.0 (C:) automated matches {Uncultured bacterium [TaxId: 77133]}
tkmdprdflqllkinaekadqkragmealcerfpraegveltltdlggvpcirqatdgag
aahilyfhgggyisgspsthlvlttqlakqssatlwsldyrlapenpfpaavddcvaayr
allktagsadriiiagdsaggglttasmlkakedglpmpaglvmlspfvdltlsrwsnsn
ladrdflaepdtlgemselyvggedrknplispvyadlsglpemlihvgseeallsdstt
laeragaagvsvelkiwpdmphvfqmygkfvnaadisikeichwisaris

SCOPe Domain Coordinates for d3k6kc_:

Click to download the PDB-style file with coordinates for d3k6kc_.
(The format of our PDB-style files is described here.)

Timeline for d3k6kc_:

  • d3k6kc_ is new in SCOPe 2.07-stable