Lineage for d3ipia_ (3ipi A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337561Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2337562Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2337969Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2337970Protein automated matches [196409] (41 species)
    not a true protein
  7. 2338053Species Methanosarcina mazei [TaxId:2209] [346213] (1 PDB entry)
  8. 2338054Domain d3ipia_: 3ipi A: [344791]
    automated match to d5xn5a_
    complexed with mla

Details for d3ipia_

PDB Entry: 3ipi (more details), 1.9 Å

PDB Description: crystal structure of a geranyltranstransferase from the methanosarcina mazei
PDB Compounds: (A:) Geranyltranstransferase

SCOPe Domain Sequences for d3ipia_:

Sequence, based on SEQRES records: (download)

>d3ipia_ a.128.1.0 (A:) automated matches {Methanosarcina mazei [TaxId: 2209]}
nieeweeyryveagikesitliedpglkkmvehvchsggkrirpiilllvseicsgsysr
slnaalavemmhsaslihddlldqglvrrnlpsapekfgpsgallcgdyliaksiafisp
ygekviqdfgkagmdmaegevldlkledesfgendyfkciykktaslfaisasigaytgg
aeeelaerfshfgnalgtayqivddileflevvegkeskftsetlphiymkstskeealk
ksidcvklhvaaaketletfrecpardklfqitdyitvdmle

Sequence, based on observed residues (ATOM records): (download)

>d3ipia_ a.128.1.0 (A:) automated matches {Methanosarcina mazei [TaxId: 2209]}
nieeweeyryveagikesitliedpglkkmvehvchsggkrirpiilllvseicsgsysr
slnaalavemmhsaslihddlldqglvrrnlpsapekfgpsgallcgdyliaksiafisp
ygekviqdfgkagmdmaegevldlkendyfkciykktaslfaisasigaytggaeeelae
rfshfgnalgtayqivddileflevvegetlphiymkstskeealkksidcvklhvaaak
etletfrecpardklfqitdyitvdmle

SCOPe Domain Coordinates for d3ipia_:

Click to download the PDB-style file with coordinates for d3ipia_.
(The format of our PDB-style files is described here.)

Timeline for d3ipia_:

  • d3ipia_ is new in SCOPe 2.07-stable