Lineage for d3ikva1 (3ikv A:1-77)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (78 species)
    not a true protein
  7. 2307652Species Thermus thermophilus [TaxId:262724] [346169] (1 PDB entry)
  8. 2307653Domain d3ikva1: 3ikv A:1-77 [344787]
    Other proteins in same PDB: d3ikva2, d3ikvb2
    automated match to d1r72a3
    complexed with ca; mutant

Details for d3ikva1

PDB Entry: 3ikv (more details), 2.4 Å

PDB Description: Crystal structure of a Rex-family repressor R90D mutant from Thermus aquaticus
PDB Compounds: (A:) Redox-sensing transcriptional repressor rex

SCOPe Domain Sequences for d3ikva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ikva1 a.4.5.0 (A:1-77) automated matches {Thermus thermophilus [TaxId: 262724]}
mkvpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgv
gytvpvlkrelrhilgl

SCOPe Domain Coordinates for d3ikva1:

Click to download the PDB-style file with coordinates for d3ikva1.
(The format of our PDB-style files is described here.)

Timeline for d3ikva1:

  • d3ikva1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3ikva2