Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (131 species) not a true protein |
Species Bacillus anthracis [TaxId:261594] [346321] (1 PDB entry) |
Domain d3i1ib_: 3i1i B: [344783] automated match to d5jkfa_ complexed with act, gol, po4 |
PDB Entry: 3i1i (more details), 2.44 Å
SCOPe Domain Sequences for d3i1ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i1ib_ c.69.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 261594]} mqivkkekfilkeytfengrtipvqmgyetygtlnrersnvilichyfsatshaagkyta hdeesgwwdgligpgkaidtnqyfvictdnlcnvqvknphvittgpksinpktgdeyamd fpvftfldvarmqcelikdmgiarlhavmgpsaggmiaqqwavhyphmvermigvitnpq npiitsvnvaqnaieairldpswkggkygeeqpmkglqlanrmmfmnafdehfyettypr nsievepyekvssltsfekeinkltyrsielvdanswmytakavllhdiahgfssleeal snveanvlmipckqdllqpsrynykmvdllqkqgkyaevyeiesinghmagvfdihlfek kvyeflnrkvss
Timeline for d3i1ib_: