SCOPe 2.08: Domain d3i1ib_: 3i1i B:

Lineage for d3i1ib_ (3i1i B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:261594] [346321] (1 PDB entry)

8. Domain d3i1ib_: 3i1i B: [344783]
   automated match to d5jkfa_
   complexed with act, gol, po4

Details for d3i1ib_

PDB Entry: 3i1i, 2.44 Å

PDB Description: x-ray crystal structure of homoserine o-acetyltransferase from bacillus anthracis

PDB Compounds: (B:) Homoserine O-acetyltransferase

SCOPe Domain Sequences for d3i1ib_:

Sequence; same for both SEQRES and ATOM records:

>d3i1ib_ c.69.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 261594]}
mqivkkekfilkeytfengrtipvqmgyetygtlnrersnvilichyfsatshaagkyta
hdeesgwwdgligpgkaidtnqyfvictdnlcnvqvknphvittgpksinpktgdeyamd
fpvftfldvarmqcelikdmgiarlhavmgpsaggmiaqqwavhyphmvermigvitnpq
npiitsvnvaqnaieairldpswkggkygeeqpmkglqlanrmmfmnafdehfyettypr
nsievepyekvssltsfekeinkltyrsielvdanswmytakavllhdiahgfssleeal
snveanvlmipckqdllqpsrynykmvdllqkqgkyaevyeiesinghmagvfdihlfek
kvyeflnrkvss

Timeline for d3i1ib_:

• d3i1ib_ first appeared in SCOPe 2.07