SCOPe 2.08: Domain d3g6dl1: 3g6d L:1-108

Lineage for d3g6dl1 (3g6d L:1-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 5 [TaxId:9606] [88540] (8 PDB entries)
   Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)

8. Domain d3g6dl1: 3g6d L:1-108 [344724]
   Other proteins in same PDB: d3g6da_, d3g6dh1, d3g6dh2, d3g6dl2
   complexed with so4

Details for d3g6dl1

PDB Entry: 3g6d, 3.2 Å

PDB Description: Crystal structure of the complex between CNTO607 Fab and IL-13

PDB Compounds: (L:) CNTO607 Fab Light chain

SCOPe Domain Sequences for d3g6dl1:

Sequence; same for both SEQRES and ATOM records:

>d3g6dl1 b.1.1.1 (L:1-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]}
syeltqppsvsvapgqtariscsgdniggtfvswyqqkpgqapvlviyddndrpsgiper
fsgsnsgntatltisgtqaedeadyycgtwdmvtnnvfgggtkltvlg

Timeline for d3g6dl1:

• d3g6dl1 first appeared in SCOPe 2.07