SCOPe 2.08: Domain d3c8ca1: 3c8c A:63-300

Lineage for d3c8ca1 (3c8c A:63-300)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.6: Sensory domain-like [103190] (5 families)
   alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain

5. Family d.110.6.4: Histidine kinase family 1 (HK1) sensor domains [345974] (6 proteins)
   Pfam PF02743, contains double domain arrangement like LuxQ

6. Protein VC_A0923 [346105] (1 species)

7. Species Vibrio cholerae [TaxId:243277] [346380] (1 PDB entry)

8. Domain d3c8ca1: 3c8c A:63-300 [344695]
   Other proteins in same PDB: d3c8ca2, d3c8cb2
   complexed with ala, mg

Details for d3c8ca1

PDB Entry: 3c8c, 1.5 Å

PDB Description: crystal structure of mcp_n and cache domains of methyl-accepting chemotaxis protein from vibrio cholerae

PDB Compounds: (A:) methyl-accepting chemotaxis protein

SCOPe Domain Sequences for d3c8ca1:

Sequence; same for both SEQRES and ATOM records:

>d3c8ca1 d.110.6.4 (A:63-300) VC_A0923 {Vibrio cholerae [TaxId: 243277]}
rsmvsdsvdeivdgvskttaevingrksiaqyatsliennpepdnvrtiisqplikntfl
lvgfglekdgsninndpswnpgptwdprvrpwykdaknagklvitapyadsasgeilvsv
atpvkdsatgqflgsifydvslaelaelvnevklfdagyvfivsedgttiahpkkefngk
pmseflgeskinvdthqviingkpyavsfsdvegedwyvgvvideeiayaaldelrrs

Timeline for d3c8ca1:

• d3c8ca1 first appeared in SCOPe 2.07