![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.6: Sensory domain-like [103190] (5 families) ![]() alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
![]() | Family d.110.6.4: Histidine kinase family 1 (HK1) sensor domains [345974] (6 proteins) Pfam PF02743, contains double domain arrangement like LuxQ |
![]() | Protein VC_A0923 [346105] (1 species) |
![]() | Species Vibrio cholerae [TaxId:243277] [346380] (1 PDB entry) |
![]() | Domain d3c8ca1: 3c8c A:63-300 [344695] Other proteins in same PDB: d3c8ca2, d3c8cb2 complexed with ala, mg |
PDB Entry: 3c8c (more details), 1.5 Å
SCOPe Domain Sequences for d3c8ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c8ca1 d.110.6.4 (A:63-300) VC_A0923 {Vibrio cholerae [TaxId: 243277]} rsmvsdsvdeivdgvskttaevingrksiaqyatsliennpepdnvrtiisqplikntfl lvgfglekdgsninndpswnpgptwdprvrpwykdaknagklvitapyadsasgeilvsv atpvkdsatgqflgsifydvslaelaelvnevklfdagyvfivsedgttiahpkkefngk pmseflgeskinvdthqviingkpyavsfsdvegedwyvgvvideeiayaaldelrrs
Timeline for d3c8ca1: