SCOPe 2.08: Domain d2rvja1: 2rvj A:438-539

Lineage for d2rvja1 (2rvj A:438-539)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)

8. Domain d2rvja1: 2rvj A:438-539 [344651]
   Other proteins in same PDB: d2rvja2
   automated match to d5uzma_

Details for d2rvja1

PDB Entry: 2rvj

PDB Description: nmr structure of epithelial splicing regulatory protein 1

PDB Compounds: (A:) Epithelial splicing regulatory protein 1

SCOPe Domain Sequences for d2rvja1:

Sequence; same for both SEQRES and ATOM records:

>d2rvja1 d.58.7.0 (A:438-539) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpptnvrdcirlrglpyaatiedildflgefatdirthgvhmvlnhqgrpsgdafiqmks
adrafmaaqkchkknmkdryvevfqcsaeemnfvlmggtlnr

Timeline for d2rvja1:

• d2rvja1 first appeared in SCOPe 2.07