SCOPe 2.08: Domain d2rf4f_: 2rf4 F:

Lineage for d2rf4f_ (2rf4 F:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.98: RNA polymerase I subunit A14-like [345896] (1 superfamily)
   alpha hairpin with 2 beta strands involved in heterodimeric interactions

4. Superfamily g.98.1: RNA polymerase I subunit A14-like [345929] (1 family)
   Pfam PF08203
   Homologous to N-terminal part of RpoF (69045) but does not include the HRDC domain (PubMed 18160037)

5. Family g.98.1.1: RNA polymerase I subunit A14 [345987] (1 protein)

6. Protein RNA polymerase I subunit A14 [346128] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346439] (2 PDB entries)

8. Domain d2rf4f_: 2rf4 F: [344650]
   Other proteins in same PDB: d2rf4a1, d2rf4a2, d2rf4c1, d2rf4c2, d2rf4e1, d2rf4e2
   protein/DNA complex; protein/RNA complex

Details for d2rf4f_

PDB Entry: 2rf4, 3.1 Å

PDB Description: crystal structure of the rna polymerase i subcomplex a14/43

PDB Compounds: (F:) DNA-directed RNA polymerase I subunit RPA4

SCOPe Domain Sequences for d2rf4f_:

Sequence; same for both SEQRES and ATOM records:

>d2rf4f_ g.98.1.1 (F:) RNA polymerase I subunit A14 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntpvvihatqlpqhvstdevlqflesfidekeniididtnlsssisqlkriqrdfkglpp

Timeline for d2rf4f_:

• d2rf4f_ first appeared in SCOPe 2.07