Lineage for d1gtxb_ (1gtx B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 318664Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 318665Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 319036Family c.67.1.4: GABA-aminotransferase-like [53417] (12 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 319055Protein 4-aminobutyrate aminotransferase, GABA-aminotransferase [53424] (1 species)
  7. 319056Species Pig (Sus scrofa) [TaxId:9823] [53425] (1 PDB entry)
  8. 319058Domain d1gtxb_: 1gtx B: [34465]

Details for d1gtxb_

PDB Entry: 1gtx (more details), 3 Å

PDB Description: 4-aminobutyrate-aminotransferase from pig

SCOP Domain Sequences for d1gtxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtxb_ c.67.1.4 (B:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa)}
fdydgplmktevpgprsrelmkqlniiqnaeavhffcnyeesrgnylvdvdgnrmldlys
qissipigyshpalvklvqqpqnvstfinrpalgilppenfveklresllsvapkgmsql
itmacgscsnenafktifmwyrskergqsafskeeletcminqapgcpdysilsfmgafh
grtmgclatthskaihkidipsfdwpiapfprlkypleefvkenqqeearcleevedliv
kyrkkkktvagiivepiqseggdnhasddffrklrdisrkhgcaflvdevqtgggstgkf
wahehwglddaadvmtfskkmmtggffhkeefrpnapyrifntwlgdpsknlllaevini
ikredllsnaahagkvlltglldlqarypqfisrvrgrgtfcsfdtpdesirnklisiar
nkgvmlggcgdksirfrptlvfrdhhahlflnifsdiladfk

SCOP Domain Coordinates for d1gtxb_:

Click to download the PDB-style file with coordinates for d1gtxb_.
(The format of our PDB-style files is described here.)

Timeline for d1gtxb_: