Lineage for d1gtxb_ (1gtx B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26196Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 26197Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 26419Family c.67.1.4: omega-Amino acid:pyruvate aminotransferase-like [53417] (11 proteins)
  6. 26428Protein 4-aminobutyrate aminotransferase, GABA-aminotransferase [53424] (1 species)
  7. 26429Species Pig (Sus scrofa) [TaxId:9823] [53425] (1 PDB entry)
  8. 26431Domain d1gtxb_: 1gtx B: [34465]

Details for d1gtxb_

PDB Entry: 1gtx (more details), 3 Å

PDB Description: 4-aminobutyrate-aminotransferase from pig

SCOP Domain Sequences for d1gtxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtxb_ c.67.1.4 (B:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa)}
fdydgplmktevpgprsrelmkqlniiqnaeavhffcnyeesrgnylvdvdgnrmldlys
qissipigyshpalvklvqqpqnvstfinrpalgilppenfveklresllsvapkgmsql
itmacgscsnenafktifmwyrskergqsafskeeletcminqapgcpdysilsfmgafh
grtmgclatthskaihkidipsfdwpiapfprlkypleefvkenqqeearcleevedliv
kyrkkkktvagiivepiqseggdnhasddffrklrdisrkhgcaflvdevqtgggstgkf
wahehwglddaadvmtfskkmmtggffhkeefrpnapyrifntwlgdpsknlllaevini
ikredllsnaahagkvlltglldlqarypqfisrvrgrgtfcsfdtpdesirnklisiar
nkgvmlggcgdksirfrptlvfrdhhahlflnifsdiladfk

SCOP Domain Coordinates for d1gtxb_:

Click to download the PDB-style file with coordinates for d1gtxb_.
(The format of our PDB-style files is described here.)

Timeline for d1gtxb_: