SCOPe 2.08: Domain d2qkgb3: 2qkg B:439-589

Lineage for d2qkgb3 (2qkg B:439-589)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species Bacillus thuringiensis [TaxId:1428] [255814] (7 PDB entries)

8. Domain d2qkgb3: 2qkg B:439-589 [344641]
   Other proteins in same PDB: d2qkga1, d2qkga2, d2qkgb1, d2qkgb2
   automated match to d3eb7a3
   complexed with act, so4

Details for d2qkgb3

PDB Entry: 2qkg, 2.3 Å

PDB Description: Crystal Structure of Insecticidal Delta-Endotoxin Cry8Ea1 from Bacillus Thuringiensis at 2.2 Angstroms Resolution

PDB Compounds: (B:) Insecticidal Delta-Endotoxin Cry8Ea1

SCOPe Domain Sequences for d2qkgb3:

Sequence; same for both SEQRES and ATOM records:

>d2qkgb3 b.18.1.0 (B:439-589) automated matches {Bacillus thuringiensis [TaxId: 1428]}
rtntvysdkitqipvvkasdgpkpsanevghylggdpisfnssgstgvirlninsplsqk
yrvrirycssvdfdldvvrggttvnngrfnksapnvgwqslkyenfkfasfstpftfnqa
qdtlkisvrnfssivggsvvyidrielipvn

Timeline for d2qkgb3:

• d2qkgb3 first appeared in SCOPe 2.07