SCOPe 2.07: Domain d2mzha2: 2mzh A:73-247

Lineage for d2mzha2 (2mzh A:73-247)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188286] (68 PDB entries)

8. Domain d2mzha2: 2mzh A:73-247 [344612]
   Other proteins in same PDB: d2mzha1
   automated match to d5ue5a2
   complexed with ca, px4, zn

Details for d2mzha2

PDB Entry: 2mzh

PDB Description: nmr solution structure of the pro form of human matrilysin (prommp-7) in complex with zwitterionic membrane

PDB Compounds: (A:) Matrilysin

SCOPe Domain Sequences for d2mzha2:

Sequence; same for both SEQRES and ATOM records:

>d2mzha2 d.92.1.0 (A:73-247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeyslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgta
dimigfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaa
thalghslgmghssdpnavmyptygngdpqnfklsqddikgiqklygkrsnsrkk

Timeline for d2mzha2:

• d2mzha2 is new in SCOPe 2.07-stable
  
• d2mzha2 appears in the current release, SCOPe 2.08