Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (18 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188286] (68 PDB entries) |
Domain d2mzha2: 2mzh A:73-247 [344612] Other proteins in same PDB: d2mzha1 automated match to d5ue5a2 complexed with ca, px4, zn |
PDB Entry: 2mzh (more details)
SCOPe Domain Sequences for d2mzha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mzha2 d.92.1.0 (A:73-247) automated matches {Human (Homo sapiens) [TaxId: 9606]} aeyslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgta dimigfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaa thalghslgmghssdpnavmyptygngdpqnfklsqddikgiqklygkrsnsrkk
Timeline for d2mzha2: