Lineage for d2mzea1 (2mze A:-2-72)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310124Fold a.20: PGBD-like [47089] (1 superfamily)
    core: 3 helices; bundle, closed, left-handed twist; parallel
  4. 2310125Superfamily a.20.1: PGBD-like [47090] (3 families) (S)
  5. 2310155Family a.20.1.0: automated matches [336862] (1 protein)
    not a true family
  6. 2310156Protein automated matches [336863] (1 species)
    not a true protein
  7. 2310157Species Human (Homo sapiens) [TaxId:9606] [336864] (5 PDB entries)
  8. 2310160Domain d2mzea1: 2mze A:-2-72 [344609]
    Other proteins in same PDB: d2mzea2
    automated match to d5ue5a1
    complexed with ca, zn

Details for d2mzea1

PDB Entry: 2mze (more details)

PDB Description: nmr solution structure of the pro form of human matrilysin (prommp-7)
PDB Compounds: (A:) Matrilysin

SCOPe Domain Sequences for d2mzea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mzea1 a.20.1.0 (A:-2-72) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lplpqeaggmselqweqaqdylkrfylydsetknansleaklkemqkffglpitgmlnsr
vieimqkprcgvpdv

SCOPe Domain Coordinates for d2mzea1:

Click to download the PDB-style file with coordinates for d2mzea1.
(The format of our PDB-style files is described here.)

Timeline for d2mzea1:

  • d2mzea1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d2mzea2