SCOPe 2.07: Domain d2illa1: 2ill A:1-100

Lineage for d2illa1 (2ill A:1-100)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2illa1: 2ill A:1-100 [344585]
   automated match to d2dm3a1
   complexed with cl

Details for d2illa1

PDB Entry: 2ill, 2.2 Å

PDB Description: Anomalous substructure of Titin-A168169

PDB Compounds: (A:) titin

SCOPe Domain Sequences for d2illa1:

Sequence; same for both SEQRES and ATOM records:

>d2illa1 b.1.1.0 (A:1-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maphfkeelrnlnvryqsnatlvckvtghpkpivkwyrqgkeiiadglkyriqefkggyh
qliiasvtdddatvyqvratnqggsvsgtaslevevpaki

Timeline for d2illa1:

• d2illa1 is new in SCOPe 2.07-stable
  
• d2illa1 appears in the current release, SCOPe 2.08