Lineage for d2dgwa1 (2dgw A:291-368)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518968Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2519561Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2519562Protein automated matches [190896] (11 species)
    not a true protein
  7. 2519599Species Human (Homo sapiens) [TaxId:9606] [188315] (94 PDB entries)
  8. 2519731Domain d2dgwa1: 2dgw A:291-368 [344560]
    Other proteins in same PDB: d2dgwa2, d2dgwa3
    automated match to d5uzma_

Details for d2dgwa1

PDB Entry: 2dgw (more details)

PDB Description: Solution structure of the second RNA recognition motif in RNA-binding protein 19
PDB Compounds: (A:) Probable RNA-binding protein 19

SCOPe Domain Sequences for d2dgwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dgwa1 d.58.7.0 (A:291-368) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttchtvklrgapfnvteknvmeflaplkpvairivrnahgnktgyifvdfsneeevkqal
kcnreymggryievfrek

SCOPe Domain Coordinates for d2dgwa1:

Click to download the PDB-style file with coordinates for d2dgwa1.
(The format of our PDB-style files is described here.)

Timeline for d2dgwa1:

  • d2dgwa1 is new in SCOPe 2.07-stable