Lineage for d2cdod_ (2cdo D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775413Species Saccharophagus degradans [TaxId:86304] [346224] (1 PDB entry)
  8. 2775417Domain d2cdod_: 2cdo D: [344556]
    automated match to d2cdpa_
    complexed with ca, cl, edo

Details for d2cdod_

PDB Entry: 2cdo (more details), 1.64 Å

PDB Description: structure of agarase carbohydrate binding module in complex with neoagarohexaose
PDB Compounds: (D:) beta-agarase 1

SCOPe Domain Sequences for d2cdod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdod_ b.18.1.0 (D:) automated matches {Saccharophagus degradans [TaxId: 86304]}
tasmaveaenfnavggtfsdgqaqpvsvytvngntainyvnqgdyadytiavaqagnyti
syqagsgvtggsiefmvnengswasktvtavpnqgwdnfqplnggsvylsagthqvrlhg
agsnnwqwnldkftlsn

SCOPe Domain Coordinates for d2cdod_:

Click to download the PDB-style file with coordinates for d2cdod_.
(The format of our PDB-style files is described here.)

Timeline for d2cdod_: