Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Saccharophagus degradans [TaxId:86304] [346224] (1 PDB entry) |
Domain d2cdod_: 2cdo D: [344556] automated match to d2cdpa_ complexed with ca, cl, edo |
PDB Entry: 2cdo (more details), 1.64 Å
SCOPe Domain Sequences for d2cdod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cdod_ b.18.1.0 (D:) automated matches {Saccharophagus degradans [TaxId: 86304]} tasmaveaenfnavggtfsdgqaqpvsvytvngntainyvnqgdyadytiavaqagnyti syqagsgvtggsiefmvnengswasktvtavpnqgwdnfqplnggsvylsagthqvrlhg agsnnwqwnldkftlsn
Timeline for d2cdod_: