Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) |
Family b.3.6.0: automated matches [227249] (1 protein) not a true family |
Protein automated matches [227026] (6 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [346219] (1 PDB entry) |
Domain d2azqa_: 2azq A: [344550] automated match to d5umhb_ complexed with fe, pcf |
PDB Entry: 2azq (more details), 2.65 Å
SCOPe Domain Sequences for d2azqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2azqa_ b.3.6.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]} vkishtadiqaffnqvagldhaegkprfkqiilrvlqdtarliedleitedefwhavdyl nrlggrneagllaaglgiehfldllqdakdaeaglgggtprtiegplyvagaplaqgevr mddgtdpgvvmflqgqvfdangkplagatvdlwhantqgtysyfdstqsefnlrrriitd aegryrarsivpsgygcdpqgptqecldllgrhgqrpahvhffisafghrhlttqinfag dkylwddfayatrdgligelrfvedaaaardrgvqgerfaelsfdfrlqgaqspdaears hrpralqeg
Timeline for d2azqa_: