Lineage for d1z4za_ (1z4z A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398195Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2398492Protein automated matches [193245] (17 species)
    not a true protein
  7. 2398601Species Simian virus 5 [TaxId:11207] [346257] (6 PDB entries)
  8. 2398604Domain d1z4za_: 1z4z A: [344548]
    automated match to d5b2da_
    complexed with ca, dan, ndg

Details for d1z4za_

PDB Entry: 1z4z (more details), 2.5 Å

PDB Description: Parainfluenza Virus 5 (SV5) Hemagglutinin-Neuraminidase (HN) with ligand DANA(soaked with sialic acid, pH7.0))
PDB Compounds: (A:) hemagglutinin-neuraminidase

SCOPe Domain Sequences for d1z4za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z4za_ b.68.1.1 (A:) automated matches {Simian virus 5 [TaxId: 11207]}
indnryinginqfyfsiaegrnltlgpllnmpsfiptattpegctripsfsltkthwcyt
hnvilngcqdhvssnqfvsmgiieptsagfpffrtlktlylsdgvnrkscsistvpggcm
mycfvstqperddyfsaappeqriiimyyndtiveriinppgvldvwatlnpgtgsgvyy
lgwvlfpiyggvikgtslwnnqankyfipqmvaalcsqnqatqvqnakssyysswfgnrm
iqsgilacplrqdltneclvlpfsndqvlmgaegrlymygdsvyyyqrsnswwpmtmlyk
vtitftngqpsaisaqnvptqqvprpgtgdcsatnrcpgfcltgvyadawlltnpsstst
fgseatftgsylntatqrinptmyianntqiissqqfgssgqeaayghttcfrdtgsvmv
yciyiielsssllgqfqivpfirqvtls

SCOPe Domain Coordinates for d1z4za_:

Click to download the PDB-style file with coordinates for d1z4za_.
(The format of our PDB-style files is described here.)

Timeline for d1z4za_:

  • d1z4za_ is new in SCOPe 2.07-stable