SCOPe 2.08: Domain d6bd9a3: 6bd9 A:461-648

Lineage for d6bd9a3 (6bd9 A:461-648)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology

6. Protein Acetohydroxyacid synthase catalytic subunit [88758] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88759] (8 PDB entries)
   Uniprot P07342 84-687

8. Domain d6bd9a3: 6bd9 A:461-648 [344491]
   Other proteins in same PDB: d6bd9a1, d6bd9a2, d6bd9b1, d6bd9b2
   complexed with fad, k, mg, oxy, po4, pyr, tpp

Details for d6bd9a3

PDB Entry: 6bd9, 1.98 Å

PDB Description: saccharomyces cerevisiae acetohydroxyacid synthase

PDB Compounds: (A:) Acetolactate synthase catalytic subunit, mitochondrial

SCOPe Domain Sequences for d6bd9a3:

Sequence, based on SEQRES records:

>d6bd9a3 c.36.1.9 (A:461-648) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeq
gmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvl
levevdkk

Sequence, based on observed residues (ATOM records):

>d6bd9a3 c.36.1.9 (A:461-648) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsg
glgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnnees
hthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvllevevdkk

Timeline for d6bd9a3:

• d6bd9a3 first appeared in SCOPe 2.07