Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) automatically mapped to Pfam PF05151 |
Family f.23.35.1: PsbM-like [161034] (2 proteins) Pfam PF05151 |
Protein automated matches [196649] (5 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [346424] (1 PDB entry) |
Domain d5xnlm_: 5xnl M: [344463] Other proteins in same PDB: d5xnl1_, d5xnl2_, d5xnl3_, d5xnl5_, d5xnl6_, d5xnl7_, d5xnla_, d5xnlb_, d5xnlc_, d5xnld_, d5xnle_, d5xnlf_, d5xnlg_, d5xnlh_, d5xnlk_, d5xnln_, d5xnlo_, d5xnlp_, d5xnls_, d5xnly_, d5xnlz_ automated match to d3a0hm_ complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat |
PDB Entry: 5xnl (more details), 2.7 Å
SCOPe Domain Sequences for d5xnlm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xnlm_ f.23.35.1 (M:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} mevnilafiatalfilvptaflliiyvktvsqs
Timeline for d5xnlm_: