Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) duplication: contains two structural repeats |
Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins) |
Protein automated matches [190507] (3 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [187461] (2 PDB entries) |
Domain d5xnl3_: 5xnl 3: [344456] Other proteins in same PDB: d5xnla_, d5xnlb_, d5xnlc_, d5xnld_, d5xnle_, d5xnlf_, d5xnlh_, d5xnlk_, d5xnlm_, d5xnlo_, d5xnlp_, d5xnls_, d5xnlz_ automated match to d1rwtf_ complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat |
PDB Entry: 5xnl (more details), 2.7 Å
SCOPe Domain Sequences for d5xnl3_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xnl3_ f.43.1.1 (3:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} dlwygpdrvkylgpfsaqtpsyltgefpgdygwdtaglsadpeafaknralevihgrwam lgalgcitpevlqkwvrvdfkepvwfkagsqifseggldylgnpnlvhaqsilavlgfqi vlmglvegfringlpdvgegndlypggqyfdplgladdpvtfaelkvkeikngrlamfsm fgffvqaivtgkgplenlldhldnpvannawvyatkfvpg
Timeline for d5xnl3_: