Lineage for d5xnl3_ (5xnl 3:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028373Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 3028374Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 3028375Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins)
  6. 3028388Protein automated matches [190507] (3 species)
    not a true protein
  7. 3028408Species Pea (Pisum sativum) [TaxId:3888] [187461] (2 PDB entries)
  8. 3028411Domain d5xnl3_: 5xnl 3: [344456]
    Other proteins in same PDB: d5xnla_, d5xnlb_, d5xnlc_, d5xnld_, d5xnle_, d5xnlf_, d5xnlh_, d5xnlk_, d5xnlm_, d5xnlo_, d5xnlp_, d5xnls_, d5xnlz_
    automated match to d1rwtf_
    complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lut, nex, oex, pho, pl9, sqd, xat

Details for d5xnl3_

PDB Entry: 5xnl (more details), 2.7 Å

PDB Description: structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum
PDB Compounds: (3:) Chlorophyll a-b binding protein, chloroplastic

SCOPe Domain Sequences for d5xnl3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xnl3_ f.43.1.1 (3:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
dlwygpdrvkylgpfsaqtpsyltgefpgdygwdtaglsadpeafaknralevihgrwam
lgalgcitpevlqkwvrvdfkepvwfkagsqifseggldylgnpnlvhaqsilavlgfqi
vlmglvegfringlpdvgegndlypggqyfdplgladdpvtfaelkvkeikngrlamfsm
fgffvqaivtgkgplenlldhldnpvannawvyatkfvpg

SCOPe Domain Coordinates for d5xnl3_:

Click to download the PDB-style file with coordinates for d5xnl3_.
(The format of our PDB-style files is described here.)

Timeline for d5xnl3_: