SCOPe 2.08: Domain d5ws5u_: 5ws5 U:

Lineage for d5ws5u_ (5ws5 U:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.2: PsbU-like [158539] (2 proteins)
   Pfam PF06514

6. Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (20 PDB entries)

8. Domain d5ws5u_: 5ws5 U: [344430]
   Other proteins in same PDB: d5ws5a_, d5ws5b_, d5ws5c_, d5ws5d_, d5ws5e_, d5ws5f_, d5ws5h_, d5ws5i_, d5ws5j_, d5ws5k_, d5ws5l_, d5ws5m1, d5ws5m2, d5ws5o_, d5ws5t_, d5ws5v_, d5ws5x_, d5ws5z_
   automated match to d2axtu1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5ws5u_

PDB Entry: 5ws5, 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash dark dataset)

PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5ws5u_:

Sequence; same for both SEQRES and ATOM records:

>d5ws5u_ a.60.12.2 (U:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]}
lvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipglt
erqkqilrenlehftvtevetalveggdrynnglyk

Timeline for d5ws5u_:

• d5ws5u_ first appeared in SCOPe 2.07