Lineage for d5ocsa_ (5ocs A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2828459Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2828460Protein automated matches [190048] (31 species)
    not a true protein
  7. 2828568Species Cupriavidus metallidurans [TaxId:119219] [338590] (1 PDB entry)
  8. 2828569Domain d5ocsa_: 5ocs A: [344388]
    automated match to d5ocsb_
    complexed with act, cit, fmn

Details for d5ocsa_

PDB Entry: 5ocs (more details), 1.7 Å

PDB Description: ene-reductase (er/oye) from ralstonia (cupriavidus) metallidurans
PDB Compounds: (A:) Putative NADH-depentdent flavin oxidoreductase

SCOPe Domain Sequences for d5ocsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ocsa_ c.1.4.0 (A:) automated matches {Cupriavidus metallidurans [TaxId: 119219]}
mphlfdpyrignlelanriaiapmcqysaqegnatdwhmihlgqmalsgaglliieatav
spegritptdlglyndaneaalgrvlgavrnhspiavtiqlahagrkasseapwdgggqi
rpdqprgwqtfapsavphaagevppaaldkagmkkirddfvaaakraarlgiegievhga
hgyllhqflspianhrtdeyggslenrmrfplevfdavreafpaerpvwmrvsatdwvpn
gwdiegtialshelkargsaavhvstggvspqqaikigpgyqvpyaqrvkaevglptmav
gliteaeqaeaiianneadiisiaramlydprwpwhaaaklgasvnapkqywrsqprgle
klfkdahfg

SCOPe Domain Coordinates for d5ocsa_:

Click to download the PDB-style file with coordinates for d5ocsa_.
(The format of our PDB-style files is described here.)

Timeline for d5ocsa_: