| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.5: PsbZ-like [161055] (2 families) ![]() automatically mapped to Pfam PF01737 |
| Family f.17.5.1: PsbZ-like [161056] (1 protein) Pfam PF01737; Ycf9 |
| Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species) |
| Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (30 PDB entries) |
| Domain d5mx2z_: 5mx2 Z: [344373] Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2c_, d5mx2d_, d5mx2e_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2m_, d5mx2o_, d5mx2t_, d5mx2u_, d5mx2v_, d5mx2x_ automated match to d3a0hz_ complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd |
PDB Entry: 5mx2 (more details), 2.2 Å
SCOPe Domain Sequences for d5mx2z_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mx2z_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
v
Timeline for d5mx2z_: