Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily) 6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops |
Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) automatically mapped to Pfam PF00421 |
Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins) Pfam PF00421 |
Protein automated matches [191285] (5 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [260540] (5 PDB entries) |
Domain d5mx2c_: 5mx2 C: [344368] Other proteins in same PDB: d5mx2a_, d5mx2d_, d5mx2e_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2m_, d5mx2o_, d5mx2t_, d5mx2u_, d5mx2v_, d5mx2x_, d5mx2z_ automated match to d5b66c_ complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd |
PDB Entry: 5mx2 (more details), 2.2 Å
SCOPe Domain Sequences for d5mx2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mx2c_ f.55.1.1 (C:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} dqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmyeqgl iliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetleeyssf fgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnptldp rvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarrafiw sgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdqklga nvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikndiqp wqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghlwhag raraaaagfekgidresepvlsmpsld
Timeline for d5mx2c_: