Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) automatically mapped to Pfam PF00016 |
Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins) N-terminal domain is alpha+beta |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species) |
Species Methanococcoides burtonii [TaxId:29291] [346274] (1 PDB entry) |
Domain d5maca2: 5mac A:140-473 [344361] Other proteins in same PDB: d5maca1, d5macb1, d5macc1, d5macd1, d5mace1 complexed with cap, cl, mg |
PDB Entry: 5mac (more details), 2.6 Å
SCOPe Domain Sequences for d5maca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5maca2 c.1.14.1 (A:140-473) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Methanococcoides burtonii [TaxId: 29291]} ydgpsytvddmrkyldvydrpilgtivkpkmgltsaeyaevcydfwvgggdfvkndepqa nqdfcpyekmvahvkeamdkavketgqkkvhsfnvsaadfdtmiercemitnagfepgsy aflidgitagwmavqtlrrrypdvflhfhraahgaftrqenpigfsvlvlskfarlagas gihtgtagigkmkgtpaedvvaahsiqylkspghffeqtwskimdtdkdvinlvnedlah hvileddswramkkccpivsgglnpvklkpfidvmenvdfittmgsgvhshpggtqsgak alvqacdaylqgmdieeyakdhkelaeaiefyln
Timeline for d5maca2: