SCOPe 2.08: Domain d5maca2: 5mac A:140-473

Lineage for d5maca2 (5mac A:140-473)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
   N-terminal domain is alpha+beta

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)

7. Species Methanococcoides burtonii [TaxId:29291] [346274] (1 PDB entry)

8. Domain d5maca2: 5mac A:140-473 [344361]
   Other proteins in same PDB: d5maca1, d5macb1, d5macc1, d5macd1, d5mace1
   complexed with cap, cl, mg

Details for d5maca2

PDB Entry: 5mac, 2.6 Å

PDB Description: crystal structure of decameric methanococcoides burtonii rubisco complexed with 2-carboxyarabinitol bisphosphate

PDB Compounds: (A:) Ribulose-1,5-bisphosphate carboxylase-oxygenase type III

SCOPe Domain Sequences for d5maca2:

Sequence; same for both SEQRES and ATOM records:

>d5maca2 c.1.14.1 (A:140-473) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Methanococcoides burtonii [TaxId: 29291]}
ydgpsytvddmrkyldvydrpilgtivkpkmgltsaeyaevcydfwvgggdfvkndepqa
nqdfcpyekmvahvkeamdkavketgqkkvhsfnvsaadfdtmiercemitnagfepgsy
aflidgitagwmavqtlrrrypdvflhfhraahgaftrqenpigfsvlvlskfarlagas
gihtgtagigkmkgtpaedvvaahsiqylkspghffeqtwskimdtdkdvinlvnedlah
hvileddswramkkccpivsgglnpvklkpfidvmenvdfittmgsgvhshpggtqsgak
alvqacdaylqgmdieeyakdhkelaeaiefyln

Timeline for d5maca2:

• d5maca2 first appeared in SCOPe 2.07