Lineage for d1elub_ (1elu B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.67: PLP-dependent transferases [53382] (1 superfamily) Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) 
Family c.67.1.3: Cystathionine synthase-like [53402] (6 proteins) 
Protein Cystine C-S lyase [53415] (1 species) Species Synechocystis sp. [TaxId:1143] [53416] (2 PDB entries) 
Domain d1elub_: 1elu B: [34435]
Details for d1elub_
PDB Entry: 1elu (more details), 1.55 Å
PDB Description: complex between the cystine c-s lyase c-des and its reaction product cysteine persulfide.
SCOP Domain Sequences for d1elub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1elub_ c.67.1.3 (B:) Cystine C-S lyase {Synechocystis sp.}
qfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaqlrqala
etfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaarfgity
rffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhqgnypv
rvlvdgaqsagslpldfsrlevdyyaftghkwfagpagvgglyihgdclgeinptyvgwr
sitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicqrsefl
wrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdciracc
hyitdeeeinhllarladfgp
SCOP Domain Coordinates for d1elub_:
Click to download the PDB-style file with coordinates for d1elub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1elub_:
- d1elub_ appears in SCOP 1.57
- d1elub_ appears in the current release, SCOPe 2.08
View in 3D
