Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311385] (176 PDB entries) |
Domain d5lovf3: 5lov F:77-378 [344345] Other proteins in same PDB: d5lova1, d5lova2, d5lovb1, d5lovb2, d5lovc1, d5lovc2, d5lovd1, d5lovd2, d5love_, d5lovf1, d5lovf2 complexed with 71e, acp, ca, gdp, gtp, mes, mg |
PDB Entry: 5lov (more details), 2.4 Å
SCOPe Domain Sequences for d5lovf3:
Sequence, based on SEQRES records: (download)
>d5lovf3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d5lovf3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviypttderevflaaynrgnvwiaisseaselldviqk ylekplllepghrkfdirswvlvdhlyniylyregvlrtpynsanygeegnemffeefnq ylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwl ievngapacaqklyaelcqgivdvaissvfplatsifikl
Timeline for d5lovf3: