Lineage for d1ecxb_ (1ecx B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 589118Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 589119Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 589415Family c.67.1.3: Cystathionine synthase-like [53402] (14 proteins)
  6. 589561Protein NifS-like protein/selenocysteine lyase [53412] (2 species)
  7. 589568Species Thermotoga maritima [TaxId:243274] [53413] (2 PDB entries)
  8. 589572Domain d1ecxb_: 1ecx B: [34432]
    complexed with cys, plp

Details for d1ecxb_

PDB Entry: 1ecx (more details), 2.7 Å

PDB Description: nifs-like protein

SCOP Domain Sequences for d1ecxb_:

Sequence, based on SEQRES records: (download)

>d1ecxb_ c.67.1.3 (B:) NifS-like protein/selenocysteine lyase {Thermotoga maritima}
mrvyfdnnattrvddrvleemivfyrekygnpnsahgmgieanlhmekarekvakvlgvs
pseifftscatesinwilktvaetfekrkrtiittpiehkavletmkylsmkgfkvkyvp
vdsrgvvkleeleklvdedtflvsimaannevgtiqpvedvtrivkkknketlvhvdavq
tigkipfsleklevdyasfsahkfhgpkgvgityirkgvpirplihgggqerglrsgtqn
vpgivgaarameiaveelseaakhmeklrsklvsglmnlgahiitpleislpntlsvsfp
nirgstlqnllsgygiyvstssactskderlrhvldamgvdrriaqgairislckyntee
evdyflkkieeilsfl

Sequence, based on observed residues (ATOM records): (download)

>d1ecxb_ c.67.1.3 (B:) NifS-like protein/selenocysteine lyase {Thermotoga maritima}
mrvyfdnnattrvddrvleemivfyrekygnpnsahgmgieanlhmekarekvakvlgvs
pseifftscatesinwilktvaetfekrkrtiittpiehkavletmkylsmkgfkvkyvp
vdsrgvvkleeleklvdedtflvsimaannevgtiqpvedvtrivkkknketlvhvdavq
tigkipfsleklevdyasfsahkfhgpkgvgityirkgvpirplihgggqerglrsgtqn
vpgivgaarameiaveelseaakhmeklrsklvsglmnlgahiitpleislpntlsvsfp
nirgstlqnllsgygiyvstrhvldamgvdrriaqgairislckynteeevdyflkkiee
ilsfl

SCOP Domain Coordinates for d1ecxb_:

Click to download the PDB-style file with coordinates for d1ecxb_.
(The format of our PDB-style files is described here.)

Timeline for d1ecxb_: