Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (29 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [321813] (4 PDB entries) |
Domain d5k3ga1: 5k3g A:2-279 [344302] Other proteins in same PDB: d5k3ga2, d5k3ga3, d5k3gb2, d5k3gb3, d5k3gc2, d5k3gc3, d5k3gd2, d5k3gd3 automated match to d5k3ic1 |
PDB Entry: 5k3g (more details), 2.86 Å
SCOPe Domain Sequences for d5k3ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k3ga1 e.6.1.0 (A:2-279) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp kmaynivdngflgfnnyriprtnllmrhtkveadgtyi
Timeline for d5k3ga1: