Lineage for d5gs1i1 (5gs1 I:1-123)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1236 PDB entries)
  8. 2356084Domain d5gs1i1: 5gs1 I:1-123 [344238]
    Other proteins in same PDB: d5gs1b_, d5gs1g2, d5gs1h2, d5gs1n_, d5gs1p_, d5gs1r_
    automated match to d5dr5l1

Details for d5gs1i1

PDB Entry: 5gs1 (more details), 2 Å

PDB Description: crystal structure of homo-specific diabody
PDB Compounds: (I:) diabody

SCOPe Domain Sequences for d5gs1i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gs1i1 b.1.1.0 (I:1-123) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyya
dsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvssgg
ggs

SCOPe Domain Coordinates for d5gs1i1:

Click to download the PDB-style file with coordinates for d5gs1i1.
(The format of our PDB-style files is described here.)

Timeline for d5gs1i1:

  • d5gs1i1 is new in SCOPe 2.07-stable