Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (160 species) not a true protein |
Species Bacillus megaterium [TaxId:1404] [319950] (2 PDB entries) |
Domain d5g0ad_: 5g0a D: [344220] automated match to d5g09b_ complexed with 1pe, peg, pg4, pge, plp |
PDB Entry: 5g0a (more details), 1.7 Å
SCOPe Domain Sequences for d5g0ad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g0ad_ c.67.1.0 (D:) automated matches {Bacillus megaterium [TaxId: 1404]} sltvqkinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqlyc vnlgqknqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvstg seavetalniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqip gssynsavlmapspnmfqdsdgnllkdengellsvkytrrmienygpeqvaavitevsqg agsamppyeyipqirkmtkelgvlwindevltgfgrtgkwfgyqhygvqpdiitmgkgls ssslpagavlvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenfveqakdsg eyirsklellqekhksignfdgygllwivdivnaktktpyvkldrnfthgmnpnqiptqi imkkalekgvliggvmpntmrigaslnvsrgdidkamdaldyaldylesgewq
Timeline for d5g0ad_: