Lineage for d5g0ad_ (5g0a D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504439Species Bacillus megaterium [TaxId:1404] [319950] (2 PDB entries)
  8. 2504443Domain d5g0ad_: 5g0a D: [344220]
    automated match to d5g09b_
    complexed with 1pe, peg, pg4, pge, plp

Details for d5g0ad_

PDB Entry: 5g0a (more details), 1.7 Å

PDB Description: the crystal structure of a s-selective transaminase from bacillus megaterium
PDB Compounds: (D:) Transaminase

SCOPe Domain Sequences for d5g0ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g0ad_ c.67.1.0 (D:) automated matches {Bacillus megaterium [TaxId: 1404]}
sltvqkinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqlyc
vnlgqknqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvstg
seavetalniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqip
gssynsavlmapspnmfqdsdgnllkdengellsvkytrrmienygpeqvaavitevsqg
agsamppyeyipqirkmtkelgvlwindevltgfgrtgkwfgyqhygvqpdiitmgkgls
ssslpagavlvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenfveqakdsg
eyirsklellqekhksignfdgygllwivdivnaktktpyvkldrnfthgmnpnqiptqi
imkkalekgvliggvmpntmrigaslnvsrgdidkamdaldyaldylesgewq

SCOPe Domain Coordinates for d5g0ad_:

Click to download the PDB-style file with coordinates for d5g0ad_.
(The format of our PDB-style files is described here.)

Timeline for d5g0ad_: