![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
![]() | Protein automated matches [190230] (23 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187072] (51 PDB entries) |
![]() | Domain d5cvma_: 5cvm A: [344178] Other proteins in same PDB: d5cvmb1, d5cvmb2, d5cvmb3 automated match to d5l8wa_ complexed with zn |
PDB Entry: 5cvm (more details), 1.9 Å
SCOPe Domain Sequences for d5cvma_:
Sequence, based on SEQRES records: (download)
>d5cvma_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hyfglvnfgntcycnsvlqalyfcrpfrenvlaykaqqkkkenlltcladlfhsiatqkk kvgvippkkfisrlrkendlfdnymqqdaheflnyllntiadilqeekkqekqngklkng nmnepaennkpeltwvheifqgtltnetrclncetvsskdedfldlsvdveqntsithcl rdfsntetlcseqkyycetccskqeaqkrmrvkklpmilalhlkrfkymeqlhrytklsy rvvfplelrlfntssdavnldrmydlvavvvhcgsgpnrghyitivkshgfwllfdddiv ekidaqaieefygltsdisknsesgyilfyqsr
>d5cvma_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hyfglvnfgntcycnsvlqalyfcrpfrenvlaykaqqkkkenlltcladlfhsiatqkk kvgvippkkfisrlrkendlfdnymqqdaheflnyllntiadilqeekkqeltwvheifq gtltnetrclncetvsskdedfldlsvdveqntsithclrdfsntetlcseqkyycetcc skqeaqkrmrvkklpmilalhlkrfkymeqlhrytklsyrvvfplelrlfntsnldrmyd lvavvvhcgsgpnrghyitivkshgfwllfdddivekidaqaieefygltsdisknsesg yilfyqsr
Timeline for d5cvma_: