Lineage for d1c7ne_ (1c7n E:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 840449Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 840450Superfamily c.67.1: PLP-dependent transferases [53383] (9 families) (S)
  5. 840802Family c.67.1.3: Cystathionine synthase-like [53402] (16 proteins)
  6. 840829Protein Cystalysin [53410] (1 species)
    PLP-dependent haemolytic enzyme
  7. 840830Species Treponema denticola [TaxId:158] [53411] (2 PDB entries)
  8. 840835Domain d1c7ne_: 1c7n E: [34417]

Details for d1c7ne_

PDB Entry: 1c7n (more details), 1.9 Å

PDB Description: crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate cofactor
PDB Compounds: (E:) cystalysin

SCOP Domain Sequences for d1c7ne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7ne_ c.67.1.3 (E:) Cystalysin {Treponema denticola [TaxId: 158]}
miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
gdggigferinlaapssviqeslerlnkalkdlk

SCOP Domain Coordinates for d1c7ne_:

Click to download the PDB-style file with coordinates for d1c7ne_.
(The format of our PDB-style files is described here.)

Timeline for d1c7ne_: