Lineage for d1c7nd_ (1c7n D:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 490721Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 490722Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 491001Family c.67.1.3: Cystathionine synthase-like [53402] (14 proteins)
  6. 491016Protein Cystalysin [53410] (1 species)
    PLP-dependent haemolytic enzyme
  7. 491017Species Treponema denticola [TaxId:158] [53411] (2 PDB entries)
  8. 491021Domain d1c7nd_: 1c7n D: [34416]

Details for d1c7nd_

PDB Entry: 1c7n (more details), 1.9 Å

PDB Description: crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate cofactor

SCOP Domain Sequences for d1c7nd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7nd_ c.67.1.3 (D:) Cystalysin {Treponema denticola}
miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
gdggigferinlaapssviqeslerlnkalkdlk

SCOP Domain Coordinates for d1c7nd_:

Click to download the PDB-style file with coordinates for d1c7nd_.
(The format of our PDB-style files is described here.)

Timeline for d1c7nd_: