Lineage for d5b5eu_ (5b5e U:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329531Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329766Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 2329767Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species)
  7. 2329772Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (20 PDB entries)
  8. 2329777Domain d5b5eu_: 5b5e U: [344156]
    Other proteins in same PDB: d5b5ea_, d5b5eb_, d5b5ec_, d5b5ed_, d5b5ee_, d5b5ef_, d5b5eh_, d5b5ei_, d5b5ej_, d5b5ek_, d5b5el_, d5b5em_, d5b5eo_, d5b5et_, d5b5ev_, d5b5ex_, d5b5ez_
    automated match to d2axtu1
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b5eu_

PDB Entry: 5b5e (more details), 1.87 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5b5eu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b5eu_ a.60.12.2 (U:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d5b5eu_:

Click to download the PDB-style file with coordinates for d5b5eu_.
(The format of our PDB-style files is described here.)

Timeline for d5b5eu_: