![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.12.2: PsbU-like [158539] (2 proteins) Pfam PF06514 |
![]() | Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (20 PDB entries) |
![]() | Domain d5b5eu_: 5b5e U: [344156] Other proteins in same PDB: d5b5ea_, d5b5eb_, d5b5ec_, d5b5ed_, d5b5ee_, d5b5ef_, d5b5eh_, d5b5ei_, d5b5ej_, d5b5ek_, d5b5el_, d5b5em_, d5b5eo_, d5b5et_, d5b5ev_, d5b5ex_, d5b5ez_ automated match to d2axtu1 complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 5b5e (more details), 1.87 Å
SCOPe Domain Sequences for d5b5eu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b5eu_ a.60.12.2 (U:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]} elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl terqkqilrenlehftvtevetalveggdrynnglyk
Timeline for d5b5eu_: