SCOPe 2.08: Domain d5avmg2: 5avm G:53-166

Lineage for d5avmg2 (5avm G:53-166)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families)

5. Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)

6. Protein Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain [55328] (3 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [346369] (1 PDB entry)

8. Domain d5avmg2: 5avm G:53-166 [344151]
   Other proteins in same PDB: d5avma1, d5avmb1, d5avmc1, d5avmd1, d5avme1, d5avmf1, d5avmg1, d5avmh1
   complexed with so4

Details for d5avmg2

PDB Entry: 5avm, 2.2 Å

PDB Description: crystal structures of 5-aminoimidazole ribonucleotide (air) synthetase, purm, from thermus thermophilus

PDB Compounds: (G:) phosphoribosylformylglycinamidine cyclo-ligase

SCOPe Domain Sequences for d5avmg2:

Sequence; same for both SEQRES and ATOM records:

>d5avmg2 d.79.4.1 (G:53-166) Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain {Thermus thermophilus HB8 [TaxId: 300852]}
epvlvattdgvgtktllaleagdvsglgfdlvnhsvndllaqgaeplffldylaashlde
gvlaallaslaeacrahgipllggetaempgvyregawdiagtlvgvversril

Timeline for d5avmg2:

• d5avmg2 first appeared in SCOPe 2.07