Lineage for d5ahjr_ (5ahj R:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2549037Protein Proteasome alpha subunit (non-catalytic) [56255] (9 species)
    contains an extension to the common fold at the N-terminus
  7. 2549053Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (237 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2550233Domain d5ahjr_: 5ahj R: [344142]
    Other proteins in same PDB: d5ahja_, d5ahjb_, d5ahjc_, d5ahjf_, d5ahjh_, d5ahji_, d5ahjj_, d5ahjk_, d5ahjl_, d5ahjm_, d5ahjn_, d5ahjo_, d5ahjp_, d5ahjq_, d5ahjt_, d5ahjv_, d5ahjw_, d5ahjx_, d5ahjy_, d5ahjz_
    automated match to d4cr2e_
    complexed with 7im, cl, mes, mg

Details for d5ahjr_

PDB Entry: 5ahj (more details), 2.8 Å

PDB Description: yeast 20s proteasome in complex with macyranone a
PDB Compounds: (R:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d5ahjr_:

Sequence, based on SEQRES records: (download)

>d5ahjr_ d.153.1.4 (R:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
aes

Sequence, based on observed residues (ATOM records): (download)

>d5ahjr_ d.153.1.4 (R:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaaes

SCOPe Domain Coordinates for d5ahjr_:

Click to download the PDB-style file with coordinates for d5ahjr_.
(The format of our PDB-style files is described here.)

Timeline for d5ahjr_: